PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P04360_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 595aa    MW: 64683.6 Da    PI: 6.1639
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P04360_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2913.3e-892515941374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                             lv+lL+e+Ae+v++++++ a+a+Larl+++  sp g+p+ R a+yf+eAL+  l++                    + l+a+k+fse
  GSMUA_Achr11P04360_001 251 LVNLLFEAAEMVEARNFSGAHAILARLNHQlPSPLGKPLIRSAFYFKEALQLILSN------------------GPNPLSAYKAFSE 319
                             689*************************998*********************9999..................4456889****** PP

                    GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgskeeleetgerLakfA 169
                             vsPi++f+++t+ qa+le+++g++r+Hi+D di+ G+QW +++q+La+R+    +   +l+iT++ ++ ++++ el+ ++++L++fA
  GSMUA_Achr11P04360_001 320 VSPIIQFANFTCIQALLEELNGSDRIHIVDSDIGFGGQWSSFMQELAQRRcstaGAVRMLKITALLPHYPHNNLELHLVRDNLSHFA 406
                             *************************************************9888666779********9999**************** PP

                    GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                             + l++pfefn+   ++l++++++eL    gEa+aVnl +   +++          +++ +lvk+lsPk+vv v+q +d+++ +Fl++
  GSMUA_Achr11P04360_001 407 SDLNIPFEFNI---HSLDSFDPSELLGLGGEAIAVNLPVGSANFP---------FPALFRLVKQLSPKIVVSVDQGCDRSDLPFLQH 481
                             **********9...69*********9999**********999998.........567****************************** PP

                    GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                             fl+a++   +l+ds++a+ +++++ + k+E++ll+++i++ v  +  +      ++  Wr  +++ GF p+++s+++++qa++ll++
  GSMUA_Achr11P04360_001 482 FLHAFKSSLVLMDSIDAS-GTNQDMACKIEKFLLQPRIESSVLGRYHA----ADKMLPWRTLFTNTGFVPLQFSNFTETQAECLLKR 563
                             ****************99.8999********************99998....88999****************************** PP

                    GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             v+++g++ve++++sl+l+W++++LvsvSaWr
  GSMUA_Achr11P04360_001 564 VQVRGFHVEKRQASLYLYWQRKELVSVSAWR 594
                             ******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.295225574IPR005202Transcription factor GRAS
PfamPF035141.1E-86251594IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MRGLPFNGQG KGGLEAVGTI LEGNQALFWV NKRPKFVIQE GVEPRSVLDH RSPSPPTSTA  60
TLSSSLGGGG SSDTAGGGGG AAGKEEWAAE LQPIPAGLDM GFVAGGEKCG VGVDDWEAML  120
SETSAASPSR EQTFLRWIMG DVDDPSAAGF KQQHHQQLLS QAPPDLDGNN GGLGFGILDP  180
CIGLGSIGRI ADDASDKPQL FGPGLLNQPP ATPNPPFFLS VGQVDHQQLP HLLIPNQPKP  240
MAAQQQLQQA LVNLLFEAAE MVEARNFSGA HAILARLNHQ LPSPLGKPLI RSAFYFKEAL  300
QLILSNGPNP LSAYKAFSEV SPIIQFANFT CIQALLEELN GSDRIHIVDS DIGFGGQWSS  360
FMQELAQRRC STAGAVRMLK ITALLPHYPH NNLELHLVRD NLSHFASDLN IPFEFNIHSL  420
DSFDPSELLG LGGEAIAVNL PVGSANFPFP ALFRLVKQLS PKIVVSVDQG CDRSDLPFLQ  480
HFLHAFKSSL VLMDSIDASG TNQDMACKIE KFLLQPRIES SVLGRYHAAD KMLPWRTLFT  540
NTGFVPLQFS NFTETQAECL LKRVQVRGFH VEKRQASLYL YWQRKELVSV SAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2728659437375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382417.10.0PREDICTED: scarecrow-like protein 27
TrEMBLM0RPB60.0M0RPB6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P04360_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20203796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-108GRAS family protein